Novus Biologicals
Manufacturer Code:NBP230943
Catalog # NBP230943
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SQTIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AI-BP; AIBPAI-BP apolipoprotein A-I binding protein apolipoprotein A-I-binding protein MGC119143 MGC119144 MGC119145 YjeF N-terminal domain-containing protein 1 YjeF_N1 YJEFN1apoA-I binding protein; apoA-I binding protein; apolipoprotein A-I binding protein; Apolipoprotein A-I-binding protein; NAD(P)H-hydrate epimerase; NAD(P)HX epimerase; YjeF N-terminal domain-containing protein 1; YjeF_N1
Gene Aliases: AIBP; APOA1BP; NAXE; YJEFN1
UniProt ID: (Human) Q8NCW5
Entrez Gene ID: (Human) 128240
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.