Novus Biologicals
Manufacturer Code:NBP189040
Catalog # NBP189040
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQPEDMFVC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: APAF1 interacting protein APAF1-interacting protein APIP2 CGI29 CGI-29 dJ179L10.2 EC 4.2.1.109 MMRP19 MTRu-1-P dehydratase probable methylthioribulose-1-phosphate dehydratase; APAF1-interacting protein; APIP; hAPIP; Methylthioribulose-1-phosphate dehydratase; MTRu-1-P dehydratase; probable methylthioribulose-1-phosphate dehydratase
Gene Aliases: APIP; APIP2; CGI-29; CGI29; hAPIP; MMRP19
UniProt ID: (Human) Q96GX9
Entrez Gene ID: (Human) 51074
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.