Novus Biologicals
Manufacturer Code:NBP181011
Catalog # NBP181011
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VPEWTKCSNREKRKEKEKPFYSDSEGESGPTESADSDPESESESDSKSSSESGSGESSSESDNEDQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: adapter-related protein complex 3 subunit beta-2; Adapter-related protein complex 3 subunit beta-2 Adaptor protein complex AP-3 subunit beta-2 adaptor-related protein complex 3 beta 2 subunit beta-3B-adaptin Clathrin assembly protein complex 3 beta-2 large chain DKFZp686D17136 NAPTBAP-3 complex subunit beta-2 Neuronal adaptin-like protein beta-subunit Neuron-specific vesicle coat protein beta-NAP; Adaptor protein complex AP-3 subunit beta-2; adaptor related protein complex 3, beta 2 subunit; Adaptor-related protein complex 3 subunit beta-2; adaptor-related protein complex 3, beta 2 subunit; AP-3 complex subunit beta-2; Beta-3B-adaptin; Clathrin assembly protein complex 3 beta-2 large chain; Neuron-specific vesicle coat protein beta-NAP; Neuronal adaptin-like protein, beta-subunit
Gene Aliases: AP3B2; NAPTB
UniProt ID: (Human) Q13367
Entrez Gene ID: (Human) 8120
Molecular Function:
membrane traffic protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.