Novus Biologicals
Manufacturer Code:NBP189228
Catalog # NBP189228
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VISVSTPAFVPTKTHVLLHRMSGKGLAAHYFFPRQPCIFGDKMVSIQITLNNTTDRKIENIHIGEKKLPIGMKMHVFNPIDSLEPEGS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Adapter-related protein complex 3 subunit beta-1 Adaptor protein complex AP-3 subunit beta-1 adaptor-related protein complex 3 beta 1 subunit ADTB3 ADTB3APE AP-3 complex subunit beta-1 beta-3A-adaptin beta3A-adaptin Clathrin assembly protein complex 3 beta-1 large chain HPS HPS2AP-3 complex beta-3A subunit; Adaptor protein complex AP-3 subunit beta-1; adaptor related protein complex 3, beta 1 subunit; Adaptor-related protein complex 3 subunit beta-1; adaptor-related protein complex 3, beta 1 subunit; AP-3 complex beta-3A subunit; AP-3 complex subunit beta-1; Beta-3A-adaptin; Clathrin assembly protein complex 3 beta-1 large chain
Gene Aliases: ADTB3; ADTB3A; AP3B1; HPS; HPS2; PE
UniProt ID: (Human) O00203
Entrez Gene ID: (Human) 8546
Molecular Function:
membrane traffic protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.