Novus Biologicals
Manufacturer Code:NBP162442
Catalog # NBP162442
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to AOC2(amine oxidase copper containing 2 (retina-specific)) The peptide sequence was selected from the middle region of AOC2 (NP_033720). Peptide sequence QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Amine oxidase [copper-containing]; Amine oxidase [copper-containing] amine oxidase copper containing 2 (retina-specific) DAO2 EC 1.4.3 RAOEC 1.4.3.21 retina-specific copper amine oxidase Semicarbazide-sensitive amine oxidase SSAO; amine oxidase copper containing 2; amine oxidase, copper containing 2 (retina-specific); RAO; Retina-specific copper amine oxidase; Semicarbazide-sensitive amine oxidase; SSAO
Gene Aliases: AOC2; DAO2; RAO
UniProt ID: (Human) O75106
Entrez Gene ID: (Human) 314
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.