Novus Biologicals
Manufacturer Code:NBP174204
Catalog # NBP174204
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the middle region of Ano6. Immunizing peptide sequence SVFIVFSTTLPKNPNGTDPIQKYLTPQMATSITASIISFIIIMILNTIYE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: anoctamin 6 anoctamin-6 MGC104751 Transmembrane protein 16FTMEM16FDKFZp313M0720; Anoctamin-6; SCAN channel; Small-conductance calcium-activated nonselective cation channel; Transmembrane protein 16F
Gene Aliases: ANO6; BDPLT7; SCTS; TMEM16F
UniProt ID: (Human) Q4KMQ2
Entrez Gene ID: (Human) 196527
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.