Novus Biologicals
Manufacturer Code:NBP17041020UL
Catalog # NBP17041020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to TMEM16C(transmembrane protein 16C) The peptide sequence was selected from the C terminal of TMEM16C. Peptide sequence AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: anoctamin 3 anoctamin-3 C11orf25 GENX-3947 TMEM16C; Anoctamin-3; Transmembrane protein 16C; transmembrane protein 16C (eight membrane-spanning domains)
Gene Aliases: ANO3; C11orf25; DYT23; DYT24; GENX-3947; TMEM16C
UniProt ID: (Human) Q9BYT9
Entrez Gene ID: (Human) 63982
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.