Novus Biologicals
Manufacturer Code:NBP159748
Catalog # NBP159748
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ANKH(ankylosis progressive homolog (mouse)) The peptide sequence was selected from the N terminal of ANKH (NP_473368). Peptide sequence SDLGYYIINKLHHVDESVGSKTRRAFLYLAAFPFMDAMAWTHAGILLKHK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ANK; ANKcraniometaphyseal dysplasia Jackson type (dominant) ankylosis progressive (mouse) homolog ankylosis progressive homolog (mouse) CCAL2 CMDJ CPPDDFLJ27166 HANKMANK KIAA1581 progressive ankylosis protein homolog; ankylosis, progressive homolog; Progressive ankylosis protein homolog
Gene Aliases: ANK; ANKH; CCAL2; CMDJ; CPPDD; HANK; KIAA1581; MANK; UNQ241/PRO274
UniProt ID: (Human) Q9HCJ1
Entrez Gene ID: (Human) 56172
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.