Novus Biologicals
Manufacturer Code:NBP238532
Catalog # NBP238532
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: IDDEVVEQRSGSSTPQRSCSAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 5'-AMP-activated protein kinase catalytic subunit alpha-2; 5'-AMP-activated protein kinase catalytic subunit alpha-2 AMPK subunit alpha-2 AMPK2 AMPK5'-AMP-activated protein kinase catalytic alpha-2 chain AMPK-alpha-2 chain EC 2.7.11 EC 2.7.11.1 PRKAA protein kinase AMP-activated alpha 2 catalytic subunit; 5'-AMP-activated protein kinase, catalytic alpha-2 chain; ACACA kinase; Acetyl-CoA carboxylase kinase; AMP-activated protein kinase alpha-2 subunit variant 2; AMP-activated protein kinase alpha-2 subunit variant 3; AMPK alpha 2; AMPK subunit alpha-2; AMPK-alpha-2 chain; HMGCR kinase; Hydroxymethylglutaryl-CoA reductase kinase; protein kinase, AMP-activated, alpha 2 catalytic subunit
Gene Aliases: AMPK; AMPK2; AMPKa2; PRKAA; PRKAA2
UniProt ID: (Human) P54646
Entrez Gene ID: (Human) 5563
Molecular Function:
kinase
non-receptor serine/threonine protein kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.