Novus Biologicals
Manufacturer Code:NBP181270
Catalog # NBP181270
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVANE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: adenosine monophosphate deaminase 1 (isoform M); adenosine monophosphate deaminase 1 adenosine monophosphate deaminase 1 (isoform M) adenosine monophosphate deaminase-1 (muscle) AMP deaminase 1 AMP deaminase isoform M AMPD EC 3.5.4.6 MAD MADA Myoadenylate deaminase skeletal muscle AMPD; adenosine monophosphate deaminase-1 (muscle); AMP deaminase 1; AMP deaminase isoform M; AMPD; Myoadenylate deaminase; skeletal muscle AMPD
Gene Aliases: AMPD1; MAD; MADA; MMDD
UniProt ID: (Human) P23109
Entrez Gene ID: (Human) 270
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.