Novus Biologicals
Manufacturer Code:NBP15672120UL
Catalog # NB5672120UL
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to AMDHD1(amidohydrolase domain containing 1) The peptide sequence was selected from the N terminal of AMDHD1. Peptide sequence AVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEEIIDCSGKCILPGLV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: amidohydrolase domain containing 1 Amidohydrolase domain-containing protein 1 EC 3.5.2.7 MGC35366 probable imidazolonepropionase; Amidohydrolase domain-containing protein 1; Probable imidazolonepropionase
Gene Aliases: AMDHD1; HMFT1272
UniProt ID: (Human) Q96NU7
Entrez Gene ID: (Human) 144193
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.