Novus Biologicals
Manufacturer Code:NBP15898720UL
Catalog # NBP15898720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CHIA(chitinase acidic) The peptide sequence was selected from the N terminal of CHIA. Peptide sequence MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acidic mammalian chitinase; acidic mammalian chitinase AMCASE CHIT2DKFZp313J1722 chitinase acidic EC 3.2.1.14 Lung-specific protein TSA1902 TSA1902AMCase; AMCase; Lung-specific protein TSA1902
Gene Aliases: AMCASE; CHIA; CHIT2; TSA1902
UniProt ID: (Human) Q9BZP6
Entrez Gene ID: (Human) 27159
Molecular Function: glycosidase hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.