Novus Biologicals
Manufacturer Code:NBP183298
Catalog # NBP183298
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SPLSSCLPIMTHASLGVDTHNSTGQIHDVPENDIVEPRKRQYVFPVSQKRGTIENERGKPLPSSPDLTRFPCTSSPEGNVTDF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha-kinase 2; alpha-kinase 2 EC 2.7.11.- FLJ34875 FLJ43253 HAKalpha-protein kinase 2 heart alpha-kinase Heart alpha-protein kinase; Alpha-protein kinase 2; heart alpha-kinase; Heart alpha-protein kinase
Gene Aliases: ALPK2; HAK
UniProt ID: (Human) Q86TB3
Entrez Gene ID: (Human) 115701
Molecular Function: Hsp70 family chaperone chaperone kinase non-receptor serine/threonine protein kinase protein kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.