Novus Biologicals
Manufacturer Code:NBP183593
Catalog # NBP183593
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:LWHHFTDVERQMTAQHYVTEFNKRLYEQNIPTQIFYIPSTILLILEDKTIKGCISVEPYILGEFVKLSNNTKVVKTEYKAT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha-kinase 1; alpha-kinase 1 alpha-protein kinase 1 Chromosome 4 kinase EC 2.7.11.- KIAA15278430410J10Rik Lak LAKFLJ22670 lymphocyte alpha-kinase Lymphocyte alpha-protein kinase; Alpha-protein kinase 1; Chromosome 4 kinase; lymphocyte alpha-kinase; Lymphocyte alpha-protein kinase
Gene Aliases: 8430410J10Rik; ALPK1; KIAA1527; LAK
UniProt ID: (Human) Q96QP1
Entrez Gene ID: (Human) 80216
Molecular Function: Hsp70 family chaperone chaperone kinase non-receptor serine/threonine protein kinase protein kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.