Novus Biologicals
Manufacturer Code:NBP238428
Catalog # NBP238428
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKETPPSFPESDKEASRLEQEYVHQVYEEIAGHFSSTR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ABH8MGC10235 AlkB homologue 8 alkB alkylation repair homolog 8 (E. coli) alkylated DNA repair protein alkB homolog 8 EC 1.14.11.- EC 2.1.1.- FLJ38204 Probable alpha-ketoglutarate-dependent dioxygenase ABH8 S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8; AlkB homologue 8; alkB, alkylation repair homolog 8; Alkylated DNA repair protein alkB homolog 8; Probable alpha-ketoglutarate-dependent dioxygenase ABH8; S-adenosyl-L-methionine-dependent tRNA methyltransferase ABH8; tRNA (carboxymethyluridine(34)-5-O)-methyltransferase ABH8; tRNA methyltransferase 9 homolog
Gene Aliases: ABH8; ALKBH8; TRM9; TRMT9
UniProt ID: (Human) Q96BT7
Entrez Gene ID: (Human) 91801
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.