Novus Biologicals
Manufacturer Code:NBP181231
Catalog # NBP181231
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GQTLLSSVHVLDLEARGYIKPHVDSIKFCGATIAGLSLLSPSVMRLVHTQEPGEWLELLLEPGSLYILRGSARYDFSHEILRDEESFFG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ABH7SPATA11 alkB alkylation repair homolog 7 (E. coli) Alkylated DNA repair protein alkB homolog 7 EC 1.14.11.- MGC10974 probable alpha-ketoglutarate-dependent dioxygenase ABH7 spermatogenesis associated 11 spermatogenesis cell proliferation related protein Spermatogenesis cell proliferation-related protein Spermatogenesis-associated protein 11 UNQ6002; alkB, alkylation repair homolog 7; Alkylated DNA repair protein alkB homolog 7; Alpha-ketoglutarate-dependent dioxygenase alkB homolog 7, mitochondrial; probable alpha-ketoglutarate-dependent dioxygenase ABH7; spermatogenesis associated 11; spermatogenesis cell proliferation related protein; Spermatogenesis cell proliferation-related protein; Spermatogenesis-associated protein 11
Gene Aliases: ABH7; ALKBH7; SPATA11; UNQ6002; UNQ6002/PRO34564
UniProt ID: (Human) Q9BT30
Entrez Gene ID: (Human) 84266
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.