Novus Biologicals
Manufacturer Code:NBP214737
Catalog # NBP214737
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TYRFIYCSDTGWAVGTEESDFEGWAFPFPGVMLIEDFVTREEEAELVRLM DRDPWKLSQSGRRKQDYGPKVN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ABH4 ALKBH4 alkB alkylation repair homolog 4 (E. coli); alkB homolog 4, lysine demthylase; alkB, alkylation repair homolog 4; Alkylated DNA repair protein alkB homolog 4; Alpha-ketoglutarate-dependent dioxygenase alkB homolog 4; DNA N6-methyl adenine demethylase ALKBH4; Lysine-specific demethylase ALKBH4; probable alpha-ketoglutarate-dependent dioxygenase ABH4
Gene Aliases: ABH4; ALKBH4
UniProt ID: (Human) Q9NXW9
Entrez Gene ID: (Human) 54784
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.