Novus Biologicals
Manufacturer Code:NBP157586
Catalog # NBP157586
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ALKBH3(alkB alkylation repair homolog 3 (E. coli)) The peptide sequence was selected from the middle region of ALKBH3. Peptide sequence EMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ABH3MGC118793 alkB alkylation repair homolog 3 (E. coli) Alkylated DNA repair protein alkB homolog 3 DEPC1alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 DEPC-1MGC118792 EC 1.14.11 EC 1.14.11.- FLJ43614 MGC118790 PCA1 Prostate cancer antigen 1 prostate cancer antigen-1; alkB homolog 3, alpha-ketoglutarate-dependent dioxygenase; alkB, alkylation repair homolog 3; Alkylated DNA repair protein alkB homolog 3; Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3; DEPC-1; hABH3; Prostate cancer antigen 1; prostate cancer antigen-1
Gene Aliases: ABH3; ALKBH3; DEPC-1; DEPC1; hABH3; PCA1
UniProt ID: (Human) Q96Q83
Entrez Gene ID: (Human) 221120
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.