Novus Biologicals
Manufacturer Code:NBP256400
Catalog # NBP256400
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FTEREQTLQVLRRLFPVDRGLFEDKVANIWCSFNVFLKIKDI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha-13-glucosyltransferase) asparagine-linked glycosylation 6 homolog (S. cerevisiae asparagine-linked glycosylation 6 homolog (yeast asparagine-linked glycosylation 6 alpha-13-glucosyltransferase homolog (S.cerevisiae) Asparagine-linked glycosylation protein 6 homolog CDG1C dolichyl pyrophosphate Man9GlcNAc2 alpha-13-glucosyltransferase Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase EC 2.4.1 EC 2.4.1.- Man(9)GlcNAc(2)-PP-Dol alpha-13-glucosyltransferase; asparagine-linked glycosylation 6 homolog (S. cerevisiae, alpha-1,3-glucosyltransferase); asparagine-linked glycosylation 6 homolog (yeast, alpha-1,3-glucosyltransferase); asparagine-linked glycosylation 6, alpha-1,3-glucosyltransferase homolog; Asparagine-linked glycosylation protein 6 homolog; Dol-P-Glc:Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase; Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase; dolichyl-P-Glc:Man(9)GlcNAc(2)-PP-dolichol alpha- 1->3-glucosyltransferase; Dolichyl-P-Glc:Man9GlcNAc2-PP-dolichyl glucosyltransferase; dolichyl-P-Glc:Man9GlcNAc2-PP-dolichylglucosyltransferase; Man(9)GlcNAc(2)-PP-Dol alpha-1,3-glucosyltransferase
Gene Aliases: ALG6; CDG1C; My046
UniProt ID: (Human) Q9Y672
Entrez Gene ID: (Human) 29929
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.