Novus Biologicals
Manufacturer Code:NBP185715
Catalog # NBP185715
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KFLLLSINRYERKKNLTLALEALVQLRGRLTSQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQSDLGQYVTFLRSFSDKQKISLLH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha-1,3-mannosyltransferase ALG2; Alpha-1,3/1,6-mannosyltransferase ALG2; alpha-13-mannosyltransferase ALG2 alpha-13-mannosyltransferase) asparagine-linked glycosylation 2 homolog (S. cerevisiae asparagine-linked glycosylation 2 homolog (yeast asparagine-linked glycosylation 2 alpha-13-mannosyltransferase homolog (S.cerevisiae) Asparagine-linked glycosylation protein 2 homolog CDGII EC 2.4.1 EC 2.4.1.- FLJ14511 GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase hALPG2 homolog of yeast ALG2 NET38; asparagine-linked glycosylation 2 homolog (S. cerevisiae, alpha-1,3-mannosyltransferase); asparagine-linked glycosylation 2 homolog (yeast, alpha-1,3-mannosyltransferase); asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog; Asparagine-linked glycosylation protein 2 homolog; GDP-Man:Man(1)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase; GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase; GDP-Man:Man(2)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; homolog of yeast ALG2
Gene Aliases: ALG2; CDGIi; CMS14; CMSTA3; hALPG2; NET38; UNQ666/PRO1298
UniProt ID: (Human) Q9H553
Entrez Gene ID: (Human) 85365
Molecular Function:
carbohydrate phosphatase
glycosyltransferase
hydrolase
nucleotidyltransferase
phosphatase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.