Novus Biologicals
Manufacturer Code:NBP19832320UL
Catalog # NBP19832320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is ALG13 - N-terminal region. Peptide sequence CVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Asparagine-linked glycosylation 13 homolog; Asparagine-linked glycosylation 13 homolog asparagine-linked glycosylation 13 homolog (S. cerevisiae) chromosome X open reading frame 45 CXorf45 EC 2.4.1.141 FLJ23018 FLJ31785 GLT28D1 glycosyltransferase 28 domain containing 1 Glycosyltransferase 28 domain-containing protein 1 hematopoietic stem/progenitor cells protein MDS031 MDS031 MGC12423 UDP-N-acetylglucosamine transferase subunit ALG13 homolog YGL047W; Glycosyltransferase 28 domain-containing protein 1; hematopoietic stem/progenitor cells protein MDS031; N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase; Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13; tudor domain containing 13; UDP-N-acetylglucosamine transferase subunit ALG13 homolog
Gene Aliases: ALG13; CDG1S; CXorf45; EIEE36; GLT28D1; MDS031; TDRD13; YGL047W
UniProt ID: (Human) B1AKD6
Entrez Gene ID: (Human) 79868
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.