Novus Biologicals
Manufacturer Code:NBP16249720UL
Catalog # NBP16249720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ALG1(asparagine-linked glycosylation 1 homolog) The peptide sequence was selected form the N terminal of ALG1. Peptide sequence VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: asparagine-linked glycosylation 1 homolog (yeast beta-14-mannosyltransferase) asparagine-linked glycosylation 1 beta-14-mannosyltransferase homolog (S.cerevisiae) Asparagine-linked glycosylation protein 1 homolog beta-14 mannosyltransferase beta-14-mannosyltransferase chitobiosyldiphosphodolichol beta-mannosyltransferase GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase GDP-mannose-dolichol diphosphochitobiose mannosyltransferase hMat-1 HMAT1EC 2.4.1.142 HMT-1 HMT1CDG1K Mannosyltransferase-1 MT-1; asparagine-linked glycosylation 1 homolog (yeast, beta-1,4-mannosyltransferase); asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog; Asparagine-linked glycosylation protein 1 homolog; beta-1,4 mannosyltransferase; Beta-1,4-mannosyltransferase; Chitobiosyldiphosphodolichol beta-mannosyltransferase; GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase; GDP-mannose-dolichol diphosphochitobiose mannosyltransferase; Mannosyltransferase-1; MT-1
Gene Aliases: ALG1; CDG1K; hMat-1; HMAT1; HMT-1; HMT1; Mat-1; MT-1; PSEC0061; UNQ861/PRO1870
UniProt ID: (Human) Q9BT22
Entrez Gene ID: (Human) 56052
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.