Novus Biologicals
Manufacturer Code:NBP238753
Catalog # NBP238753
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AEGAQIWCGEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANNVKYGLAATVWSSNVGRVHRVAKKLQSGLVW |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2-aminomuconic semialdehyde dehydrogenase; Aldehyde dehydrogenase 12; Aldehyde dehydrogenase 12 aldehyde dehydrogenase 8 family member A1 aldehyde dehydrogenase family protein ALDH12aldehyde dehydrogenase family 8 member A1 DJ352A20.2 DKFZp779D2315 EC 1.2.1 EC 1.2.1.- EC 1.2.1.3 MGC138650; aldehyde dehydrogenase 8 family, member A1; Aldehyde dehydrogenase family 8 member A1; aldehyde dehydrogenase family protein
Gene Aliases: ALDH12; ALDH8A1; DJ352A20.2
UniProt ID: (Human) Q9H2A2
Entrez Gene ID: (Human) 64577
Molecular Function: dehydrogenase oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.