Novus Biologicals
Manufacturer Code:NBP15473920UL
Catalog # NBP15473920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ALDH4A1(aldehyde dehydrogenase 4 family member A1) The peptide sequence was selected from the N terminal of ALDH4A1. Peptide sequence QGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: aldehyde dehydrogenase 4 family member A1 Aldehyde dehydrogenase family 4 member A1 ALDH4DKFZp779M035 delta-1-pyrroline-5-carboxylate dehydrogenase mitochondrial EC 1.5.1.12 mitochondrial delta-1-pyrroline 5-carboxylate dehydrogenase P5C dehydrogenase P5CD P5CDh; aldehyde dehydrogenase 4 family, member A1; Aldehyde dehydrogenase family 4 member A1; Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; L-glutamate gamma-semialdehyde dehydrogenase; mitochondrial delta-1-pyrroline 5-carboxylate dehydrogenase; P5C dehydrogenase
Gene Aliases: ALDH4; ALDH4A1; P5CD; P5CDH
UniProt ID: (Human) P30038
Entrez Gene ID: (Human) 8659
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.