Novus Biologicals
Manufacturer Code:NBP191657
Catalog # NBP191657
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: acetaldehyde dehydrogenase 6; aldehyde dehydrogenase 1 family member A3 Aldehyde dehydrogenase 6 aldehyde dehydrogenase family 1 member A3 ALDH1A6 ALDH6acetaldehyde dehydrogenase 6 EC 1.2.1 EC 1.2.1.5 RalDH3 RALDH-3 Retinaldehyde dehydrogenase 3; aldehyde dehydrogenase 1 family, member A3; Aldehyde dehydrogenase 6; Aldehyde dehydrogenase family 1 member A3; RALDH-3; Retinaldehyde dehydrogenase 3
Gene Aliases: ALDH1A3; ALDH1A6; ALDH6; MCOP8; RALDH3
UniProt ID: (Human) P47895
Entrez Gene ID: (Human) 220
Molecular Function: dehydrogenase oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.