Novus Biologicals
Manufacturer Code:NBP256509
Catalog # NBP256509
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AFAR1 AFARAFB1-AR1 AFB1 aldehyde reductase 1 AFB1-AR 1 aflatoxin B1 aldehyde reductase member 2 aflatoxin beta1 aldehyde reductase AKR7 aldo-keto reductase family 7 member A2 (aflatoxin aldehyde reductase) Aldoketoreductase 7 EC 1.1.1.n11 SSA reductase Succinic semialdehyde reductase; AFB1 aldehyde reductase 1; AFB1-AR 1; aflatoxin aldehyde reductase; Aflatoxin B1 aldehyde reductase member 2; aflatoxin beta1 aldehyde reductase; aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase); Aldoketoreductase 7; epididymis secretory sperm binding protein Li 166mP; HEL-S-166mP; SSA reductase; Succinic semialdehyde reductase
Gene Aliases: AFAR; AFAR1; AFB1-AR1; AKR7; AKR7A2
UniProt ID: (Human) O43488
Entrez Gene ID: (Human) 8574
Molecular Function:
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.