Novus Biologicals
Manufacturer Code:NBP174082
Catalog # NBP174082
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the middle region of AKR1D1 (NP_005980). Peptide Sequence: YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-oxo-5-beta-steroid 4-dehydrogenase; 3o5bred Aldo-keto reductase family 1 member D13-oxo-5-beta-steroid 4-dehydrogenase aldo-keto reductase family 1 member D1 (delta4-3-ketosteroid-5-beta-reductase) CBAS2 Delta(4)-3-oxosteroid 5-beta-reductase EC 1.3.1.3 SRD5B1beta polypeptide 1 (3-oxo-5 beta-steroid delta4-dehydrogenase beta 1); Aldo-keto reductase family 1 member D1; delta 4-3-ketosteroid-5-beta-reductase; Delta(4)-3-ketosteroid 5-beta-reductase; Delta(4)-3-oxosteroid 5-beta-reductase; steroid-5-beta-reductase, beta polypeptide 1 (3-oxo-5 beta-steroid delta 4-dehydrogenase beta 1)
Gene Aliases: 3o5bred; AKR1D1; CBAS2; SRD5B1
UniProt ID: (Human) P51857
Entrez Gene ID: (Human) 6718
Molecular Function: oxidoreductase reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.