Novus Biologicals
Manufacturer Code:NBP157770
Catalog # NBP157770
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human AKR1C2. Peptide sequence: DGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-alpha-HSD3; Aldo-keto reductase family 1 member C2; aldo-keto reductase family 1 member C2 aldo-keto reductase family 1 member C2 (dihydrodiol dehydrogenase 2 bile acidbinding protein 3-alpha hydroxysteroid dehydrogenase type III) BABP Chlordecone reductase homolog HAKRD DD DD-2 DD2DD/BABP DDH2FLJ53800 Dihydrodiol dehydrogenase 2 Dihydrodiol dehydrogenase/bile acid-binding protein EC 1.1.13-alpha-HSD3 EC 1.1.1.213 EC 1.3.1.20 HAKRDAKR1C-pseudo HBAB MCDR2 pseudo-chlordecone reductase Trans-12-dihydrobenzene-12-diol dehydrogenase type II dihydrodiol dehydrogenase Type III 3-alpha-hydroxysteroid dehydrogenase; Chlordecone reductase homolog HAKRD; DD-2; DD/BABP; Dihydrodiol dehydrogenase 2; dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III; Dihydrodiol dehydrogenase/bile acid-binding protein; pseudo-chlordecone reductase; testicular 17,20-desmolase deficiency; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; type II dihydrodiol dehydrogenase; Type III 3-alpha-hydroxysteroid dehydrogenase
Gene Aliases: AKR1C-pseudo; AKR1C2; BABP; DD; DD-2; DD/BABP; DD2; DDH2; HAKRD; HBAB; MCDR2; SRXY8; TDD
UniProt ID: (Human) P52895
Entrez Gene ID: (Human) 1646
Molecular Function:
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.