Novus Biologicals
Manufacturer Code:NBP189146
Catalog # NBP189146
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:CTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADR Aldehyde reductase Aldo-keto reductase family 1 member B1 aldo-keto reductase family 1 member B1 (aldose reductase) ALDR1aldose reductase ALR2 ARaldehyde reductase 1 EC 1.1.1 EC 1.1.1.21 Lii5-2 CTCL tumor antigen low Km aldose reductase MGC1804; Aldehyde reductase; aldehyde reductase 1; Aldo-keto reductase family 1 member B1; aldo-keto reductase family 1, member B1 (aldose reductase); Aldose reductase; AR; Lii5-2 CTCL tumor antigen; low Km aldose reductase
Gene Aliases: ADR; AKR1B1; ALDR1; ALR2; AR
UniProt ID: (Human) P15121
Entrez Gene ID: (Human) 231
Molecular Function:
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.