Novus Biologicals
Manufacturer Code:NBP15639520UL
Catalog # NBP15639520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C6ORF199 The peptide sequence was selected from the middle region of C6ORF199. Peptide sequence IINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEVIENHRKKKKEAQK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Adenylate kinase 9; adenylate kinase domain containing 1; adenylate kinase domain containing 1 adenylate kinase domain containing 2 adenylate kinase domain-containing protein 1 Adenylate kinase domain-containing protein 2 AKD2 C6orf199 C6orf224 chromosome 6 open reading frame 199 chromosome 6 open reading frame 224 dJ70A9.1 FLJ16163 FLJ25791 FLJ34784 FLJ42177 MGC126763 MGC138153 MGC177059 MGC180194 MGC184281 MGC26954 RP1-70A9.1; adenylate kinase domain containing 2; Adenylate kinase domain-containing protein 1; Adenylate kinase domain-containing protein 2; AK 9
Gene Aliases: AK 9; AK9; AKD1; AKD2; C6orf199; C6orf224; dJ70A9.1
UniProt ID: (Human) Q5TCS8
Entrez Gene ID: (Human) 221264
Molecular Function:
kinase
nucleotide kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.