Novus Biologicals
Manufacturer Code:NBP15480720UL
Catalog # NBP15480720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to AKAP5(A kinase (PRKA) anchor protein 5) The peptide sequence was selected from the middle region of AKAP5 (NP_004848). Peptide sequence KQFLISAENEQVGVFANDNGFEDRTSEQYETLLIETASSLVKNAIQLSIE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: A kinase (PRKA) anchor protein 5; A kinase (PRKA) anchor protein 5 AKAP 79 AKAP7979kDa A-kinase anchor protein 79 kDa A-kinase anchoring protein 75/79 cAMP-dependent protein kinase regulatory subunit II high affinity bindingprotein cAMP-dependent protein kinase regulatory subunit II high affinity-bindingprotein H21; A-kinase anchor protein 5; A-kinase anchor protein 79 kDa; A-kinase anchoring protein 75/79; AKAP 79; AKAP-5; cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein; H21
Gene Aliases: AKAP5; AKAP75; AKAP79; H21
UniProt ID: (Human) P24588
Entrez Gene ID: (Human) 9495
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.