Novus Biologicals
Manufacturer Code:NBP15650920UL
Catalog # NBP15650920
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human AKAP10 (NP_009133). Peptide sequence ESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVRKSKGSMFSQAMKKWVQ. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: A kinase (PRKA) anchor protein 10; A kinase (PRKA) anchor protein 10 AKAP-10 A-kinase anchor protein 10 mitochondrial D-AKAP2 D-AKAP-2 Dual specificity A kinase-anchoring protein 2 dual-specificity A-kinase anchoring protein 2 MGC9414 mitochondrial A kinase PPKA anchor protein 10 PRKA10a kinase anchor protein 10 mitochondrial protein kinase A anchoring protein 10 Protein kinase A-anchoring protein 10; A kinase anchor protein 10; A-kinase anchor protein 10, mitochondrial; AKAP-10; D-AKAP-2; Dual specificity A kinase-anchoring protein 2; mitochondrial A kinase PPKA anchor protein 10; PRKA10; protein kinase A anchoring protein 10; Protein kinase A-anchoring protein 10
Gene Aliases: AKAP-10; AKAP10; D-AKAP-2; D-AKAP2; PRKA10
UniProt ID: (Human) O43572
Entrez Gene ID: (Human) 11216
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.