Novus Biologicals
Manufacturer Code:NBP154639
Catalog # NBP154639
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to AK2(adenylate kinase 2) The peptide sequence was selected from the N terminal of AK2. Peptide sequence MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDML. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: adenylate kinase 2 adenylate kinase 2 mitochondrial adenylate kinase isoenzyme 2 mitochondrial ADK2 AK 2 ATP-AMP transphosphorylase 2 EC 2.7.4 EC 2.7.4.3; Adenylate kinase 2, mitochondrial; Adenylate kinase 2, mitochondrial, N-terminally processed; adenylate kinase isoenzyme 2, mitochondrial; Adenylate monophosphate kinase; AK 2; ATP-AMP transphosphorylase 2; ATP:AMP phosphotransferase; testis secretory sperm-binding protein Li 220n
Gene Aliases: ADK2; AK2
UniProt ID: (Human) P54819
Entrez Gene ID: (Human) 204
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.