Novus Biologicals
Manufacturer Code:NBP15765520UL
Catalog # NBP15765520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to AHCYL1(S-adenosylhomocysteine hydrolase-like 1) The peptide sequence was selected from the N terminal of AHCYL1. Peptide sequence MSMPDAMPLPGVGEELKQAKEIEDAEKYSFMATVTKAPKKQIQFADDMQE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: adenosylhomocysteinase-like 1; adenosylhomocysteinase-like 1 AdoHcyase 2 DCAL DC-expressed AHCY-like molecule dendritic cell expressed AHCY-like protein inositol 145-trisphosphate receptor-binding protein IRBIT PRO0233 putative adenosylhomocysteinase 2 S-adenosyl homocysteine hydrolase homolog S-adenosylhomocysteine hydrolase-like 1 S-adenosylhomocysteine hydrolase-like protein 1 S-adenosyl-L-homocysteine hydrolase 2 XPVKONAEC 3.3.1.1; AdoHcyase 2; DC-expressed AHCY-like molecule; dendritic cell expressed AHCY-like protein; inositol 1,4,5-trisphosphate receptor-binding protein; IP(3)Rs binding protein released with IP(3); IRBIT; protein phosphatase 1, regulatory subunit 78; Putative adenosylhomocysteinase 2; S-adenosyl homocysteine hydrolase homolog; S-adenosyl-L-homocysteine hydrolase 2; S-adenosylhomocysteine hydrolase-like protein 1
Gene Aliases: AHCYL1; DCAL; IRBIT; PPP1R78; PRO0233; XPVKONA
UniProt ID: (Human) O43865
Entrez Gene ID: (Human) 10768
Molecular Function: hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.