Novus Biologicals
Manufacturer Code:NBP189200
Catalog # NBP189200
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:HPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTPLYMDRQGIDILYSGS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AGT; AGT1L-alanine: glyoxylate aminotransferase 1 AGThepatic peroxisomal alanine:glyoxylate aminotransferase AGXT1 alanine-glyoxylate aminotransferase Alanine--glyoxylate aminotransferase EC 2.6.1.44 EC 2.6.1.51 PH1 serine:pyruvate aminotransferase SPATserine-pyruvate aminotransferase SPTserine--pyruvate aminotransferase TLH6; Alanine--glyoxylate aminotransferase; hepatic peroxisomal alanine:glyoxylate aminotransferase; L-alanine: glyoxylate aminotransferase 1; Serine--pyruvate aminotransferase; serine-pyruvate aminotransferase; serine:pyruvate aminotransferase; SPT
Gene Aliases: AGT; AGT1; AGXT; AGXT1; PH1; SPAT; SPT; TLH6
UniProt ID: (Human) P21549
Entrez Gene ID: (Human) 189
Molecular Function:
transaminase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.