Novus Biologicals
Manufacturer Code:NBP159006
Catalog # NBP159006
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to AGTR1(angiotensin II receptor type 1) The peptide sequence was selected from the N terminal of AGTR1 (NP_004826). Peptide sequence ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: AG2S AGTR1AAngiotensin II type-1 receptor Angiostensin Receptor angiotensin II receptor type 1 angiotensin receptor 1 angiotensin receptor 1B AT1AT1AR AT1B AT1R AT2R1A AT2R1AGTR1B AT2R1BAT1BR HAT1R type-1 angiotensin II receptor type-1B angiotensin II receptor; angiotensin II receptor, type 1; Angiotensin II type-1 receptor; AT1; AT1AR; AT1BR; Type-1 angiotensin II receptor; type-1B angiotensin II receptor
Gene Aliases: AG2S; AGTR1; AGTR1A; AGTR1B; AT1; AT1AR; AT1B; AT1BR; AT1R; AT2R1; AT2R1B; HAT1R
UniProt ID: (Human) P30556
Entrez Gene ID: (Human) 185
Molecular Function:
G-protein coupled receptor
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.