Novus Biologicals
Manufacturer Code:NBP190210
Catalog # NBP190210
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:HLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYGKLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-acylglycerol-3-phosphate O-acyltransferase 7; 1-acylglycerol-3-phosphate O-acyltransferase 7 (lysophosphatidic acid acyltransferase, eta); 1-acylglycerophosphocholine O-acyltransferase; 1-acylglycerophosphoserine O-acyltransferase; 1-AGP acyltransferase 7; 1-AGPAT 7; 1-alkenylglycerophosphoethanolamine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; acyl-CoA:lysophosphatidylethanolamine acyltransferase 2; acyltransferase like 3; acyltransferase like 3 Acyltransferase-like 3 AGPAT7acyl-CoA:lysophosphatidylethanolamine acyltransferase 2 AYTL3lysophospholipid acyltransferase LPCAT41-acylglycerol-3-phosphate O-acyltransferase 7 (lysophosphatidic acidacyltransferase eta) EC 2.3.1 EC 2.3.1.- EC 2.3.1.23 FLJ102571-acylglycerol-3-phosphate O-acyltransferase 7 LPAAT-eta LPEAT21-AGPAT 7 lysophosphatidylcholine acyltransferase 41-AGP acyltransferase 7 Lysophosphatidylethanolamine acyltransferase 2 PLSC domain containing protein; Acyltransferase-like 3; Lysophosphatidylcholine acyltransferase 4; Lysophosphatidylethanolamine acyltransferase 2; Lysophospholipid acyltransferase LPCAT4; Plasmalogen synthase; PLSC domain containing protein
Gene Aliases: AGPAT7; AYTL3; LPAAT-eta; LPCAT4; LPEAT2
UniProt ID: (Human) Q643R3
Entrez Gene ID: (Human) 254531
Molecular Function:
acyltransferase
annexin
calcium-binding protein
calmodulin
intracellular calcium-sensing protein
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.