Novus Biologicals
Manufacturer Code:NBP255555
Catalog # NBP255555
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha; 1-acylglycerol-3-phosphate O-acyltransferase 1; 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase); 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha); 1-acylglycerol-3-phosphate O-acyltransferase 1 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme Athiolase) 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acidacyltransferase alpha) 1-AGP acyltransferase 1 1-AGPAT1 EC 2.3.1.51 G15 LPAATA LPAAT-alpha1-acyl-sn-glycerol-3-phosphate acyltransferase alpha Lysophosphatidic acid acyltransferase alpha lysophospholipid acyltransferase MGC40071-AGPAT 1 MGC5423 Protein G15; 1-AGP acyltransferase 1; 1-AGPAT 1; LPAAT-alpha; Lysophosphatidic acid acyltransferase alpha; lysophospholipid acyltransferase; Protein G15
Gene Aliases: 1-AGPAT1; AGPAT1; G15; LPAAT-alpha; LPAATA
UniProt ID: (Human) Q99943
Entrez Gene ID: (Human) 10554
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.