Novus Biologicals
Manufacturer Code:NBP15552420UL
Catalog # NBP15552420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ADSSL1(adenylosuccinate synthase like 1) The peptide sequence was selected from the middle region of ADSSL1 (NP_689541). Peptide sequence VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: adenylosuccinate synthase like 1 adenylosuccinate synthetase isozyme 1 Adenylosuccinate synthetase basic isozyme Adenylosuccinate synthetase muscle isozyme ADSL1 AdSS 1 ADSS1 AMPSase 1 EC 6.3.4.4 FLJ38602 IMP--aspartate ligase 1 M-type adenylosuccinate synthetase; Adenylosuccinate synthetase isozyme 1; Adenylosuccinate synthetase, basic isozyme; Adenylosuccinate synthetase, muscle isozyme; Adenylosuccinate synthetase-like 1; adSS 1; AdSSL1; AMPSase 1; IMP--aspartate ligase 1; M-type adenylosuccinate synthetase
Gene Aliases: ADSS1; ADSSL1
UniProt ID: (Human) Q8N142
Entrez Gene ID: (Human) 122622
Molecular Function:
ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.