Novus Biologicals
Manufacturer Code:NBP179668
Catalog # NBP179668
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human C17orf48The immunogen for this antibody is C17ORF48. Peptide sequence MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent; ADP-ribose/CDP-alcohol pyrophosphatase; ADPRibase-Mn; ADPRibase-Mn ADP-ribose/CDP-alcohol diphosphatase manganese-dependent ADPRM C17orf48 chromosome 17 open reading frame 48 manganese-dependent ADP-ribose/CDP-alcohol diphosphatase MDS006 NBLA03831; CDP-choline phosphohydrolase; Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
Gene Aliases: ADPRM; C17orf48; MDS006; NBLA03831
UniProt ID: (Human) Q3LIE5
Entrez Gene ID: (Human) 56985
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.