Novus Biologicals
Manufacturer Code:NBP188835
Catalog # NBP188835
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SEHFLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTAIYCFLR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: [Protein ADP-ribosylarginine] hydrolase-like protein 2; [Protein ADP-ribosylarginine] hydrolase-like protein 2 ADP-ribosylhydrolase 3 ADP-ribosylhydrolase like 2 ARH3EC 3.2.1.143 FLJ20446 poly(ADP-ribose) glycohydrolase ARH3 protein ADP-ribosylarginine hydrolase-like protein 2; [Protein ADP-ribosylserine] hydrolase; ADP-ribose glycohydrolase ARH3; ADP-ribosylarginine hydrolase like 2; ADP-ribosylhydrolase 3; O-acetyl-ADP-ribose deacetylase ARH3; Poly(ADP-ribose) glycohydrolase ARH3; protein ADP-ribosylarginine hydrolase-like protein 2
Gene Aliases: ADPRHL2; ADPRS; ARH3
UniProt ID: (Human) Q9NX46
Entrez Gene ID: (Human) 54936
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.