Novus Biologicals
Manufacturer Code:NBP256772
Catalog # NBP256772
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SPGNGKDHSILHSRNDLEEAFIHFMGKGAAAERFFSDKETFHDIAQVASEFPGAQHYVGGNAALIGQKFAANSDLKVLLC |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADP-dependent glucokinase; ADP-dependent glucokinase ADP-GKrbBP-35 ATP-dependent glucokinase DKFZp434B195 EC 2.7.1.1472610017G09Rik RbBP-35; ADP-GK; ATP-dependent glucokinase; RbBP-35
Gene Aliases: 2610017G09Rik; ADP-GK; ADPGK; PSEC0260
UniProt ID: (Human) Q9BRR6
Entrez Gene ID: (Human) 83440
Molecular Function: kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.