Novus Biologicals
Manufacturer Code:NBP258966
Catalog # NBP258966
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ADE2 AIR carboxylase AIRCADE2H1 DKFZp781N1372 MGC1343 MGC5024 multifunctional protein ADE2 PAIS phosphoribosylaminoimidazole carboxylase phosphoribosylaminoimidazolesuccinocarboxamide synthetase SAICAR synthetase; AIR carboxylase; AIRC; Multifunctional protein ADE2; multifunctional protein ADE2H1; Phosphoribosylaminoimidazole carboxylase; phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase; Phosphoribosylaminoimidazole-succinocarboxamide synthase; SAICAR synthetase
Gene Aliases: ADE2; ADE2H1; AIRC; PAICS; PAIS
UniProt ID: (Human) P22234
Entrez Gene ID: (Human) 10606
Molecular Function: ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.