Novus Biologicals
Manufacturer Code:NBP230495
Catalog # NBP230495
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QAGNEEMVQIDLPIKRYREYELVTPVSTNLEGRYLSHTLSASHKKRSARDVSSNPEQLFFNITAFGKDFHLRLKPNTQL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: A disintegrin and metalloproteinase with thrombospondin motifs 3; A disintegrin and metalloproteinase with thrombospondin motifs 3 a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif 3 ADAM metallopeptidase with thrombospondin type 1 motif 3 ADAM-TS 3 ADAM-TS3 ADAMTS-3 ADAMTS-4 EC 3.4.24 EC 3.4.24.- EC 3.4.24.14 KIAA0366PC II-NP Procollagen II amino propeptide-processing enzyme Procollagen II N-proteinase zinc metalloendopeptidase; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 3; ADAM metallopeptidase with thrombospondin type 1 motif, 3; ADAM-TS 3; ADAM-TS3; ADAMTS-3; PC II-NP; Procollagen II amino propeptide-processing enzyme; Procollagen II N-proteinase; zinc metalloendopeptidase
Gene Aliases: ADAMTS-4; ADAMTS3; KIAA0366
UniProt ID: (Human) O15072
Entrez Gene ID: (Human) 9508
Molecular Function:
enzyme modulator
extracellular matrix glycoprotein
extracellular matrix protein
hydrolase
metalloprotease
protease
protease inhibitor
serine protease inhibitor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.