Novus Biologicals
Manufacturer Code:NBP157095
Catalog # NBP157095
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ADAMTS18(ADAM metallopeptidase with thrombospondin type 1 motif 18) The peptide sequence was selected from the N terminal of ADAMTS18. Peptide sequence FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: A disintegrin and metalloproteinase with thrombospondin motifs 18; A disintegrin and metalloproteinase with thrombospondin motifs 18 a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif 18 a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif 21 ADAM metallopeptidase with thrombospondin type 1 motif 18 ADAM-TS 18 ADAM-TS18 ADAMTS-18 ADAMTS21 disintegrin and metalloprotease-like protein EC 3.4.24.- EC 3.4.24.82; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 18; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 21; ADAM-TS 18; disintegrin and metalloprotease-like protein
Gene Aliases: ADAMTS18; ADAMTS21; KNO2; MMCAT
UniProt ID: (Human) Q8TE60
Entrez Gene ID: (Human) 170692
Molecular Function:
enzyme modulator
extracellular matrix glycoprotein
extracellular matrix protein
hydrolase
metalloprotease
protease
protease inhibitor
serine protease inhibitor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.