Novus Biologicals
Manufacturer Code:NBP189248
Catalog # NBP189248
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: A disintegrin and metalloproteinase with thrombospondin motifs 10; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 10; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif 10 ADAM metallopeptidase with thrombospondin type 1 motif 10 ADAM-TS 10 ADAMTS-10 ADAM-TS10A disintegrin and metalloproteinase with thrombospondin motifs 10 EC 3.4.24.- EC 3.4.24.82 WMS zinc metalloendopeptidase; ADAM metallopeptidase with thrombospondin type 1 motif, 10; ADAM-TS 10; zinc metalloendopeptidase
Gene Aliases: ADAM-TS10; ADAMTS-10; ADAMTS10; WMS; WMS1
UniProt ID: (Human) Q9H324
Entrez Gene ID: (Human) 81794
Molecular Function:
enzyme modulator
extracellular matrix glycoprotein
extracellular matrix protein
hydrolase
metalloprotease
protease
protease inhibitor
serine protease inhibitor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.