Novus Biologicals
Manufacturer Code:NBP162430
Catalog # NBP162430
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ADAM30(ADAM metallopeptidase domain 30) The peptide sequence was selected from the N terminal of ADAM30. Peptide sequence IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: a disintegrin and metalloproteinase domain 30; a disintegrin and metalloproteinase domain 30 ADAM 30 ADAM metallopeptidase domain 30 disintegrin and metalloproteinase domain-containing protein 30 EC 3.4.24.- svph4; ADAM 30; Disintegrin and metalloproteinase domain-containing protein 30
Gene Aliases: ADAM30; svph4; UNQ2509/PRO5997
UniProt ID: (Human) Q9UKF2
Entrez Gene ID: (Human) 11085
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.