Novus Biologicals
Manufacturer Code:NBP214263
Catalog # NBP214263
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DILMVTKDVIKEFADDGVKYLELRSTPRRENATGMTKKTYVESILEGIKQ SKQENLDIDVRYLIAVDRRGGPLVAKETVKLAE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: adenosine deaminase-like adenosine deaminase-like protein DKFZp313B2137 EC 3.5.4 EC 3.5.4.- FLJ44620; Adenosine deaminase-like protein; Adenosine deaminase-like protein isoform 1; HsMAPDA; N6-mAMP deaminase; N6-methyl-AMP aminohydrolase
Gene Aliases: ADAL; ADAL1
UniProt ID: (Human) Q6DHV7
Entrez Gene ID: (Human) 161823
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.