Novus Biologicals
Manufacturer Code:NBP15751120UL
Catalog # NBP157520UL
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ADAD2(adenosine deaminase domain containing 2) The peptide sequence was selected from the C terminal of ADAD2. Peptide sequence TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: adenosine deaminase domain containing 2 adenosine deaminase domain-containing protein 2 TENRLFLJ00337 Testis nuclear RNA-binding protein-like; Adenosine deaminase domain-containing protein 2; Testis nuclear RNA-binding protein-like
Gene Aliases: ADAD2; TENRL
UniProt ID: (Human) Q8NCV1
Entrez Gene ID: (Human) 161931
Molecular Function: DNA binding protein RNA binding protein deaminase defense/immunity protein enzyme modulator hydrolase kinase activator kinase modulator nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.