Novus Biologicals
Manufacturer Code:NBP15660220UL
Catalog # NBP15660220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to ACTR3B(ARP3 actin-related protein 3 homolog B (yeast)) Antibody(against the N terminal of ACTR3B. Peptide sequence MAGSLPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Actin-like protein 3B; actin-related protein 3-beta; Actin-related protein 3B; actin-related protein 3B actin-related protein 3-beta actin-related protein Arp11 Actin-related protein ARP4 ARP11Actin-like protein 3B ARP3 actin-related protein 3 homolog B (yeast) ARP3beta ARP3-beta ARP4 DKFZp686O24114; actin-related protein Arp11; Actin-related protein ARP4; ARP3 actin-related protein 3 homolog B; ARP3-beta
Gene Aliases: ACTR3B; ARP11; ARP3BETA; ARP4
UniProt ID: (Human) Q9P1U1
Entrez Gene ID: (Human) 57180
Molecular Function:
actin and actin related protein
actin family cytoskeletal protein
cytoskeletal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.